PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold03373-abinit-gene-0.2-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family WOX
Protein Properties Length: 362aa    MW: 41491.4 Da    PI: 8.2263
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold03373-abinit-gene-0.2-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.44.4e-2285144357
                                                           --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHH CS
                                              Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRak 54 
                                                           +R+++t+eql++Leel+++ +r+psae++++++++l    +++ ++V++WFqN++a+
  augustus_masked-scaffold03373-abinit-gene-0.2-mRNA-1  85 SRWNPTPEQLRALEELYRRgTRTPSAEQIQHITAQLrrygKIEGKNVFYWFQNHKAR 141
                                                           7*****************99************************************* PP

                                                           HHC CS
                                              Homeobox  55 ekk 57 
                                                           e++
  augustus_masked-scaffold03373-abinit-gene-0.2-mRNA-1 142 ERQ 144
                                                           *97 PP

2Wus_type_Homeobox115.13.4e-3784146365
                                     Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrka 59 
                                                           ++RW+PtpeQ++ Leely++G+rtP++e+iq+ita+L++yGkie+kNVfyWFQN+ka
  augustus_masked-scaffold03373-abinit-gene-0.2-mRNA-1  84 SSRWNPTPEQLRALEELYRRGTRTPSAEQIQHITAQLRRYGKIEGKNVFYWFQNHKA 140
                                                           79******************************************************* PP

                                     Wus_type_Homeobox  60 Rerqkq 65 
                                                           Rerqk+
  augustus_masked-scaffold03373-abinit-gene-0.2-mRNA-1 141 RERQKR 146
                                                           ****95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003892.6E-582149IPR001356Homeobox domain
SuperFamilySSF466893.85E-1385151IPR009057Homeodomain-like
PfamPF000469.0E-2085144IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.4E-985144IPR009057Homeodomain-like
CDDcd000862.97E-686146No hitNo description
PROSITE profilePS5007111.22490145IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048513Biological Processanimal organ development
GO:0099402Biological Processplant organ development
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MWMVGYNDGG EFNMPDSFNG RKLRPLIPRP LPSTNIINNN STANTPGLSR IHGTDFFSQC  60
QHLQAVVSEQ NKMREFNTPP VVVSSRWNPT PEQLRALEEL YRRGTRTPSA EQIQHITAQL  120
RRYGKIEGKN VFYWFQNHKA RERQKRRRQM DLASDDPHRD NIEILNRKEL GANRTVFEVE  180
QTKNWAPHTN CSTLAEESVS IQRSAKAAVA ECMTDGWIQF DEGELQQRRN FVERNATRQI  240
MQLTCPPHLT HLINTPTSST TTATTTTTQA TVRTTMDQKL IKTRDLNIFI APYRENGINY  300
FNSSVSNEED GCGESQTLQL FPLRSSSDGN NNINEKETDI SVSAMNANFT PFQFFEFLPL  360
KN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015882736.11e-170PREDICTED: WUSCHEL-related homeobox 1
TrEMBLA0A0B2PRZ21e-166A0A0B2PRZ2_GLYSO; WUSCHEL-related homeobox 1
TrEMBLK7KRE91e-166K7KRE9_SOYBN; Uncharacterized protein
STRINGGLYMA05G33850.21e-166(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28923471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.13e-52WUSCHEL related homeobox 1